Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF37A Peptide - middle region

ZNF37A Peptide - middle region

Product Specifications

Product Name Alternative

FLJ3472, KOX21, ZNF37

UniProt

P17032

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF37A Rabbit Polyclonal Antibody (orb580082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007095

Preservative

Lyophilized powder

AA Sequence

ECGKSFSEKSTLTQHQRTHTGEKPYECHECGKTFSFKSVLTVHQKTHTGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arrb1 (NM_178220) Mouse Recombinant Protein
TP525799 20 µg

Arrb1 (NM_178220) Mouse Recombinant Protein

Sign In for Pricing
View Details
C1QC (Complement C1q Subcomponent Subunit C, C1QG) (MaxLight 490)
124102-ML490 100 µL

C1QC (Complement C1q Subcomponent Subunit C, C1QG) (MaxLight 490)

Sign In for Pricing
View Details
GSTO1 ORF Vector (Human) (pORF)
ORF004715 1.0 µg DNA

GSTO1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
BMI1 antibody
70R-15307 0.1 mg

BMI1 antibody

Sign In for Pricing
View Details
SLC28A3 Recombinant Protein (Rat)
RP229328 100 µg

SLC28A3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
E-Cadherin / CD324 Antibody
orb1460889 100 µg

E-Cadherin / CD324 Antibody

Sign In for Pricing
View Details