Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF471 Peptide - N-terminal region

ZNF471 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ERP1, KIAA1396, MGC150657, MGC150658, Z1971

UniProt

Q9BX82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF471 Rabbit Polyclonal Antibody (orb577116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065864

Preservative

Lyophilized powder

AA Sequence

MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM14 (aa414-427) Immunizing Peptide
orb66205 100 µg

PRDM14 (aa414-427) Immunizing Peptide

Sign In for Pricing
View Details
Apolipoprotein AII, Human Plasma
16-16-120102-500ug 500ug

Apolipoprotein AII, Human Plasma

Sign In for Pricing
View Details
pLVX-CMV-MAGI2-FLAG-PGK-Puro Plasmid
PVT42105 2 µg

pLVX-CMV-MAGI2-FLAG-PGK-Puro Plasmid

Sign In for Pricing
View Details
ASB5 sgRNA CRISPR Lentivector (Human) (Target 2)
K0131503 1.0 µg DNA

ASB5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Bovine DNA excision repair protein ERCC-6-like, ERCC6L ELISA Kit
MBS9323446-01 48 Well

Bovine DNA excision repair protein ERCC-6-like, ERCC6L ELISA Kit

Sign In for Pricing
View Details
Bovine DNA excision repair protein ERCC-6-like, ERCC6L ELISA Kit
MBS9323446-02 96 Well

Bovine DNA excision repair protein ERCC-6-like, ERCC6L ELISA Kit

Sign In for Pricing
View Details