Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF471 Peptide - N-terminal region

ZNF471 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ERP1, KIAA1396, MGC150657, MGC150658, Z1971

UniProt

Q9BX82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF471 Rabbit Polyclonal Antibody (orb577116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065864

Preservative

Lyophilized powder

AA Sequence

MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Isocitrate Dehydrogenase 1, Soluble (IDH1) ELISA Kit
orb2812013-01 48 Tests

Rat Isocitrate Dehydrogenase 1, Soluble (IDH1) ELISA Kit

Sign In for Pricing
View Details
Rat Isocitrate Dehydrogenase 1, Soluble (IDH1) ELISA Kit
orb2812013-02 96 Tests

Rat Isocitrate Dehydrogenase 1, Soluble (IDH1) ELISA Kit

Sign In for Pricing
View Details
Rat Isocitrate Dehydrogenase 1, Soluble (IDH1) ELISA Kit
orb2812013-03 5 x 96 T

Rat Isocitrate Dehydrogenase 1, Soluble (IDH1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human CD27 pAb
PA12331-01 50 μL

Rabbit Anti-Human CD27 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human CD27 pAb
PA12331-02 100 μL

Rabbit Anti-Human CD27 pAb

Sign In for Pricing
View Details
ZNF281 Antibody; Biotin conjugated
MBS7005077-01 0.05 mg

ZNF281 Antibody; Biotin conjugated

Sign In for Pricing
View Details