Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF483 Peptide - middle region

ZNF483 Peptide - middle region

Product Specifications

Product Name Alternative

ZKSCAN16

UniProt

Q8TF39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF483 Rabbit Polyclonal Antibody (orb580187) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597721

Preservative

Lyophilized powder

AA Sequence

QNKTLGSGSRGKKFDPDKSPFGHNFKETSDLIKHLRVYLRKKSRRYNESK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZCCHC13 (h) -PR
sc-90854-PR 10 µM - 20 µL

ZCCHC13 (h) -PR

Sign In for Pricing
View Details
IKKB (Phospho-S701) Blocking peptide
orb1441171 500 µg

IKKB (Phospho-S701) Blocking peptide

Sign In for Pricing
View Details
Tyrosinase (TYR, LB24 AB, LB24-AB, Monophenol Monooxygenase, Oculocutaneous Albinism IA, OCA1A, OCAIA, SK29 AB, SK29-AB, Tumor Rejection Antigen AB) (FITC)
MBS6258641-01 0.1 mL

Tyrosinase (TYR, LB24 AB, LB24-AB, Monophenol Monooxygenase, Oculocutaneous Albinism IA, OCA1A, OCAIA, SK29 AB, SK29-AB, Tumor Rejection Antigen AB) (FITC)

Sign In for Pricing
View Details
Tyrosinase (TYR, LB24 AB, LB24-AB, Monophenol Monooxygenase, Oculocutaneous Albinism IA, OCA1A, OCAIA, SK29 AB, SK29-AB, Tumor Rejection Antigen AB) (FITC)
MBS6258641-02 5x 0.1 mL

Tyrosinase (TYR, LB24 AB, LB24-AB, Monophenol Monooxygenase, Oculocutaneous Albinism IA, OCA1A, OCAIA, SK29 AB, SK29-AB, Tumor Rejection Antigen AB) (FITC)

Sign In for Pricing
View Details
USP37 CRISPR Activation Plasmid (m)
sc-435650-ACT 20 µg

USP37 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
PerCP/Fire™ 780 anti-mouse CD335 (NKp46)
GT04187 25 µg

PerCP/Fire™ 780 anti-mouse CD335 (NKp46)

Sign In for Pricing
View Details