Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF511 Peptide - middle region

ZNF511 Peptide - middle region

Product Specifications

Product Name Alternative

MGC30006

UniProt

Q8NB15

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF511 Rabbit Polyclonal Antibody (orb575830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665805

Preservative

Lyophilized powder

AA Sequence

KPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCH1 (F8T4M) Rabbit Monoclonal Antibody
CST 36788T 20 µL

GCH1 (F8T4M) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GBE1 Conjugated Antibody
C39035 100 µL

GBE1 Conjugated Antibody

Sign In for Pricing
View Details
HIS-Tag Mouse mAb (8F5)
MBS8539633-01 0.1 mL

HIS-Tag Mouse mAb (8F5)

Sign In for Pricing
View Details
HIS-Tag Mouse mAb (8F5)
MBS8539633-02 0.1 mL (AF405L)

HIS-Tag Mouse mAb (8F5)

Sign In for Pricing
View Details
HIS-Tag Mouse mAb (8F5)
MBS8539633-03 0.1 mL (AF405S)

HIS-Tag Mouse mAb (8F5)

Sign In for Pricing
View Details
HIS-Tag Mouse mAb (8F5)
MBS8539633-04 0.1 mL (AF610)

HIS-Tag Mouse mAb (8F5)

Sign In for Pricing
View Details