Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF511 Peptide - middle region

ZNF511 Peptide - middle region

Product Specifications

Product Name Alternative

MGC30006

UniProt

Q8NB15

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF511 Rabbit Polyclonal Antibody (orb575830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665805

Preservative

Lyophilized powder

AA Sequence

KPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Macrophage Inflammatory Protein 1alpha (MIP-1alpha/CCL3) ELISA Kit
MBS3808064-01 48 Well

Rat Macrophage Inflammatory Protein 1alpha (MIP-1alpha/CCL3) ELISA Kit

Sign In for Pricing
View Details
Rat Macrophage Inflammatory Protein 1alpha (MIP-1alpha/CCL3) ELISA Kit
MBS3808064-02 96 Well

Rat Macrophage Inflammatory Protein 1alpha (MIP-1alpha/CCL3) ELISA Kit

Sign In for Pricing
View Details
Rat Macrophage Inflammatory Protein 1alpha (MIP-1alpha/CCL3) ELISA Kit
MBS3808064-03 5x 96 Well

Rat Macrophage Inflammatory Protein 1alpha (MIP-1alpha/CCL3) ELISA Kit

Sign In for Pricing
View Details
Rat Macrophage Inflammatory Protein 1alpha (MIP-1alpha/CCL3) ELISA Kit
MBS3808064-04 10x 96 Well

Rat Macrophage Inflammatory Protein 1alpha (MIP-1alpha/CCL3) ELISA Kit

Sign In for Pricing
View Details
Anti-FHL1 Monoclonal Antibody
MBS1752078-01 0.03 mL

Anti-FHL1 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-FHL1 Monoclonal Antibody
MBS1752078-02 0.1 mL

Anti-FHL1 Monoclonal Antibody

Sign In for Pricing
View Details