Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF514 Peptide - N-terminal region

ZNF514 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126229, MGC126230

UniProt

Q96K75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF514 Rabbit Polyclonal Antibody (orb575788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116177

Preservative

Lyophilized powder

AA Sequence

HSDWKRRSKSKESMPSWGISKEELFQVVSVEKHIQDVLQFSKLKAACGCD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAGE-2A Double Nickase Plasmid (h2)
sc-416976-NIC-2 20 µg

LAGE-2A Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
MEK2 Rabbit Monoclonal Antibody
E49Y5863 100 µL

MEK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SLC22A6 Protein Lysate (Rat) with C-HA Tag
43963036 100 µg

SLC22A6 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)
SIPB041Ra01-01 10 µg

Recombinant Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)

Sign In for Pricing
View Details
Recombinant Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)
SIPB041Ra01-02 50 µg

Recombinant Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)

Sign In for Pricing
View Details
Recombinant Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)
SIPB041Ra01-03 200 µg

Recombinant Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)

Sign In for Pricing
View Details