Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF514 Peptide - N-terminal region

ZNF514 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126229, MGC126230

UniProt

Q96K75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF514 Rabbit Polyclonal Antibody (orb575788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116177

Preservative

Lyophilized powder

AA Sequence

HSDWKRRSKSKESMPSWGISKEELFQVVSVEKHIQDVLQFSKLKAACGCD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgfr4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6769205 3x 1.0 µg

Fgfr4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
MCM2 Antibody
E51A13425 100 µL

MCM2 Antibody

Sign In for Pricing
View Details
TNFRSF8 Antibody (N-term)
E45R04703G-1 100 µL

TNFRSF8 Antibody (N-term)

Sign In for Pricing
View Details
Rectum adenocarcinoma (grade 2) tissue array with adjacent normal tissue, including pathology grade, TNM and clinical stage, 24 cases/72 cores
DRE723 24 Cases / 72 Cores

Rectum adenocarcinoma (grade 2) tissue array with adjacent normal tissue, including pathology grade, TNM and clinical stage, 24 cases/72 cores

Sign In for Pricing
View Details
Recombinant EBV/HHV4 BLLF1/MA/GP350 Protein, N-His
orb3151424-01 50 µg

Recombinant EBV/HHV4 BLLF1/MA/GP350 Protein, N-His

Sign In for Pricing
View Details
Recombinant EBV/HHV4 BLLF1/MA/GP350 Protein, N-His
orb3151424-02 100 µg

Recombinant EBV/HHV4 BLLF1/MA/GP350 Protein, N-His

Sign In for Pricing
View Details