Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF514 Peptide - middle region

ZNF514 Peptide - middle region

Product Specifications

Product Name Alternative

MGC126229, MGC126230

UniProt

Q96K75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF514 Rabbit Polyclonal Antibody (orb577256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116177

Preservative

Lyophilized powder

AA Sequence

GRAFSQSSSLTQHYRFHTGEKPYKCNECGRAFAHTASLIKHQRSHAGKKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Stimulating Hormone, beta (TSHb) (MaxLight 750)
MBS6265385-01 0.1 mL

Thyroid Stimulating Hormone, beta (TSHb) (MaxLight 750)

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, beta (TSHb) (MaxLight 750)
MBS6265385-02 5x 0.1 mL

Thyroid Stimulating Hormone, beta (TSHb) (MaxLight 750)

Sign In for Pricing
View Details
Speer4e Protein Vector (Mouse) (pPB-C-His)
PV233230 500 ng

Speer4e Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rno-miR-344i miRNA Inhibitor
orb1868325-01 10 nmol

Rno-miR-344i miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-344i miRNA Inhibitor
orb1868325-02 20 nmol

Rno-miR-344i miRNA Inhibitor

Sign In for Pricing
View Details
TP53I3 Antibody
OACA07167-100UL 100 µL

TP53I3 Antibody

Sign In for Pricing
View Details