Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF514 Peptide - middle region

ZNF514 Peptide - middle region

Product Specifications

Product Name Alternative

MGC126229, MGC126230

UniProt

Q96K75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF514 Rabbit Polyclonal Antibody (orb577256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116177

Preservative

Lyophilized powder

AA Sequence

GRAFSQSSSLTQHYRFHTGEKPYKCNECGRAFAHTASLIKHQRSHAGKKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBG CRISPR Activation Plasmid (h2)
sc-406575-ACT-2 20 µg

CBG CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
CCL3 Antibody
KC-7250-01 50 μL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-7250-02 100 µL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-7250-03 1 mL

CCL3 Antibody

Sign In for Pricing
View Details
Anti-IL-4 Antibody
CPA1590-01 30 µL

Anti-IL-4 Antibody

Sign In for Pricing
View Details
Anti-IL-4 Antibody
CPA1590-02 50 μL

Anti-IL-4 Antibody

Sign In for Pricing
View Details