Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF514 Peptide - middle region

ZNF514 Peptide - middle region

Product Specifications

Product Name Alternative

MGC126229, MGC126230

UniProt

Q96K75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF514 Rabbit Polyclonal Antibody (orb577256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116177

Preservative

Lyophilized powder

AA Sequence

GRAFSQSSSLTQHYRFHTGEKPYKCNECGRAFAHTASLIKHQRSHAGKKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF7 Antibody
E38QA9593 100 µL

RNF7 Antibody

Sign In for Pricing
View Details
CD16 antibody (Azide Free)
10R-CD16GMSP 0.5 mg

CD16 antibody (Azide Free)

Sign In for Pricing
View Details
Dryocrassin ABBA
MBS3611769-01 5 mg

Dryocrassin ABBA

Sign In for Pricing
View Details
Dryocrassin ABBA
MBS3611769-02 10 mg

Dryocrassin ABBA

Sign In for Pricing
View Details
Dryocrassin ABBA
MBS3611769-03 5x 10 mg

Dryocrassin ABBA

Sign In for Pricing
View Details
Magic™ Membrane Protein Human STMP1 (ShoRoom Temperature transmembrane mitochondrial protein 1) Full Length
MPC2197K Each

Magic™ Membrane Protein Human STMP1 (ShoRoom Temperature transmembrane mitochondrial protein 1) Full Length

Sign In for Pricing
View Details