ZNF514 Peptide - middle region
ZNF514 Peptide - middle region
Product Specifications
Product Name Alternative
MGC126229, MGC126230
UniProt
Q96K75
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF514 Rabbit Polyclonal Antibody (orb577256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116177
Preservative
Lyophilized powder
AA Sequence
GRAFSQSSSLTQHYRFHTGEKPYKCNECGRAFAHTASLIKHQRSHAGKKT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1354869-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana Cyclin-A2-3 (CYCA2-3)
Sign In for Pricing
View Details MBS1354869-02 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana Cyclin-A2-3 (CYCA2-3)
Sign In for Pricing
View Details MBS1354869-03 0.1 mg (E-Coli)
Recombinant Arabidopsis thaliana Cyclin-A2-3 (CYCA2-3)
Sign In for Pricing
View Details MBS1354869-04 0.1 mg (Yeast)
Recombinant Arabidopsis thaliana Cyclin-A2-3 (CYCA2-3)
Sign In for Pricing
View Details