Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF540 Peptide - N-terminal region

ZNF540 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp313K2238, DKFZp547B0714, FLJ16004, Nbla10512

UniProt

Q8NDQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF540 Rabbit Polyclonal Antibody (orb575858) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689819

Preservative

Lyophilized powder

AA Sequence

SLSKESIIEKSKTLRLKGSIFRNEWQNKSEFEGQQGLKERSISQKKIVSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Gelsolin (GS)
MBS2041516-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gelsolin (GS)
MBS2041516-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gelsolin (GS)
MBS2041516-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gelsolin (GS)
MBS2041516-04 1 mL

Cy3-Linked Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gelsolin (GS)
MBS2041516-05 5 mL

Cy3-Linked Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gelsolin (GS)
MBS2041516-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details