Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF574 Peptide - C-terminal region

ZNF574 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22059, FP972

UniProt

Q6ZN55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_073589

Preservative

Lyophilized powder

AA Sequence

ATPTKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGATVPSAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tofacitinib Impurity P
TRC-T528025-10MG 10 mg

Tofacitinib Impurity P

Sign In for Pricing
View Details
Recombinant Human EGF Protein (Fc Tag)
PDMH100210-01 20 µg

Recombinant Human EGF Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human EGF Protein (Fc Tag)
PDMH100210-02 100 µg

Recombinant Human EGF Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human EGF Protein (Fc Tag)
PDMH100210-03 500 µg

Recombinant Human EGF Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human EGF Protein (Fc Tag)
PDMH100210-04 1 mg

Recombinant Human EGF Protein (Fc Tag)

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF640R conjugate, 0.1mg/mL
BNC400824-500 1x 500 µL

CD68 (LAMP4/824), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details