Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF574 Peptide - C-terminal region

ZNF574 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22059, FP972

UniProt

Q6ZN55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_073589

Preservative

Lyophilized powder

AA Sequence

ATPTKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGATVPSAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM54A (MTFR2) Mouse Monoclonal Antibody [Clone ID: OTI2G8]
CF811420 100 µg

FAM54A (MTFR2) Mouse Monoclonal Antibody [Clone ID: OTI2G8]

Sign In for Pricing
View Details
Apbb1ip Mouse Gene Knockout Kit (CRISPR)
KN501384 1 Kit

Apbb1ip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TET1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E2]
TA802234AM 100 µL

TET1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E2]

Sign In for Pricing
View Details
MAP1LC3B2 Human Gene Knockout Kit (CRISPR)
KN423078 1 Kit

MAP1LC3B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Lefty1 activation kit by CRISPRa
GA201162 1 Kit

Mouse Lefty1 activation kit by CRISPRa

Sign In for Pricing
View Details
Malignant fibrous histiocytoma (MFHAS1) Human Gene Knockout Kit (CRISPR)
KN424081 1 Kit

Malignant fibrous histiocytoma (MFHAS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details