Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF579 Peptide - C-terminal region

ZNF579 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ35453

UniProt

Q8NAF0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF579 Rabbit Polyclonal Antibody (orb575856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689813

Preservative

Lyophilized powder

AA Sequence

LASYLRQHRRVHGPLSLLAPLPAAGKKDDKASGARNSAKGPEGGEGAECG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIA40 (CHCHD4) (NM_001098502) Human Over-expression Lysate
LC420602 20 µg

MIA40 (CHCHD4) (NM_001098502) Human Over-expression Lysate

Sign In for Pricing
View Details
REG3A (NM_138937) Human Recombinant Protein
TP316966 20 µg

REG3A (NM_138937) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS503612 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Multi-Well Plates
DP1100-RD-9I-NS 50 Pack/Case

Multi-Well Plates

Sign In for Pricing
View Details
MIR941-4 Human qPCR Primer Pair (MI0005766)
HP300681 200 Reactions

MIR941-4 Human qPCR Primer Pair (MI0005766)

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/3121R), CF568 conjugate, 0.1mg/mL
BNC683121-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/3121R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details