Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF579 Peptide - C-terminal region

ZNF579 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ35453

UniProt

Q8NAF0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF579 Rabbit Polyclonal Antibody (orb575856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689813

Preservative

Lyophilized powder

AA Sequence

LASYLRQHRRVHGPLSLLAPLPAAGKKDDKASGARNSAKGPEGGEGAECG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r67 Mouse Gene Knockout Kit (CRISPR)
KN519082 1 Kit

Vmn1r67 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
JAKMIP3 (NM_001105521) Human Over-expression Lysate
LY426248 100 µg

JAKMIP3 (NM_001105521) Human Over-expression Lysate

Sign In for Pricing
View Details
Stard5 Mouse Gene Knockout Kit (CRISPR)
KN516839 1 Kit

Stard5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant CCT2 Antibody
RC-16036-01 50 μL

Recombinant CCT2 Antibody

Sign In for Pricing
View Details
Recombinant CCT2 Antibody
RC-16036-02 100 µL

Recombinant CCT2 Antibody

Sign In for Pricing
View Details
Recombinant CCT2 Antibody
RC-16036-03 1 mL

Recombinant CCT2 Antibody

Sign In for Pricing
View Details