Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF599 Peptide - N-terminal region

ZNF599 Peptide - N-terminal region

Product Specifications

UniProt

Q96NL3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF599 Rabbit Polyclonal Antibody (orb581061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007249

Preservative

Lyophilized powder

AA Sequence

MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 (CD99 Antigen, CD99 Molecule, 12E7, E2 Antigen, HBA71, MIC2, MIC2X, MIC2Y, Monoclonal Antibody 12E7, MSK5X, Protein MIC2, Surface Antigen MIC2, T cell Surface Glycoprotein E2 Precursor) discontinued
C2444-02D 100 µg

CD99 (CD99 Antigen, CD99 Molecule, 12E7, E2 Antigen, HBA71, MIC2, MIC2X, MIC2Y, Monoclonal Antibody 12E7, MSK5X, Protein MIC2, Surface Antigen MIC2, T cell Surface Glycoprotein E2 Precursor) discontinued

Sign In for Pricing
View Details
Goat Polyclonal MCM2 Antibody [DyLight 550]
NB100-244R 0.1 mL

Goat Polyclonal MCM2 Antibody [DyLight 550]

Sign In for Pricing
View Details
STX6 Polyclonal Antibody
A57693-020 20 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
11-Mercaptoundecanoate-NHS
orb3021956-01 50 mg

11-Mercaptoundecanoate-NHS

Sign In for Pricing
View Details
11-Mercaptoundecanoate-NHS
orb3021956-02 10 mg

11-Mercaptoundecanoate-NHS

Sign In for Pricing
View Details
Pla2g4c AAV siRNA Pooled Vector
36913164 1.0 µg

Pla2g4c AAV siRNA Pooled Vector

Sign In for Pricing
View Details