Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF624 Peptide - N-terminal region

ZNF624 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1349, MGC119602, MGC119603, MGC119605

UniProt

Q9P2J8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF624 Rabbit Polyclonal Antibody (orb581159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065838

Preservative

Lyophilized powder

AA Sequence

MSLQDSTLSREGKPEGEIMAAVFFSVGRLSPEVTQPDEDLHLQAEETQLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NUDT19 activation kit by CRISPRa
GA118182 1 Kit

Human NUDT19 activation kit by CRISPRa

Sign In for Pricing
View Details
IQ motif containing B1 (IQCB1) Rabbit Polyclonal Antibody
TA363624 100 µL

IQ motif containing B1 (IQCB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Diisoheptyl Phthalate (mixture of C7 isomers)
TRC-D455720-5ML 5 mL

Diisoheptyl Phthalate (mixture of C7 isomers)

Sign In for Pricing
View Details
CAMK2D (NM_172127) Human Recombinant Protein
TP307454 20 µg

CAMK2D (NM_172127) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), Biotin conjugate, 0.1mg/mL
BNCB1877-500 1x 500 µL

Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS702873 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details