Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF624 Peptide - N-terminal region

ZNF624 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1349, MGC119602, MGC119603, MGC119605

UniProt

Q9P2J8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF624 Rabbit Polyclonal Antibody (orb581159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065838

Preservative

Lyophilized powder

AA Sequence

MSLQDSTLSREGKPEGEIMAAVFFSVGRLSPEVTQPDEDLHLQAEETQLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bop1 Mouse Gene Knockout Kit (CRISPR)
KN502225 1 Kit

Bop1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ITIH2 (C-term) Rabbit Polyclonal Antibody
AP17511PU-N 400 µL

ITIH2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR56B4 (NM_001005181) Human Over-expression Lysate
LC423967 20 µg

OR56B4 (NM_001005181) Human Over-expression Lysate

Sign In for Pricing
View Details
SMN1 (NM_000344) Human Recombinant Protein
TP321367L 1 mg

SMN1 (NM_000344) Human Recombinant Protein

Sign In for Pricing
View Details
NME2 Recombinant Rabbit Monoclonal Antibody [JE40-86]
HA722553 100 µL

NME2 Recombinant Rabbit Monoclonal Antibody [JE40-86]

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3), CF568 conjugate, 0.1mg/mL
BNC680049-100 1x 100 µL

CD31 / PECAM-1 (C31.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details