Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF655 Peptide - N-terminal region

ZNF655 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686M1631, FLJ23461, MGC10859, MGC16203, MGC5521, VIK, VIK-1

UniProt

D6W5T4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076966

Preservative

Lyophilized powder

AA Sequence

QVPALPREGSPGDQAAALLTARYQEFVTFEDVAVHLTREEWGYLDPVQRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), Biotin conjugate, 0.1mg/mL
BNCB2470-500 1x 500 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF706 (NM_001042511) Human Over-expression Lysate
LY420951 100 µg

ZNF706 (NM_001042511) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Deoxycytidine Kinase (DCK) ELISA Kit
RD-DCK-Hu-01 96 Tests

Human Deoxycytidine Kinase (DCK) ELISA Kit

Sign In for Pricing
View Details
Human Deoxycytidine Kinase (DCK) ELISA Kit
RD-DCK-Hu-02 48 Tests

Human Deoxycytidine Kinase (DCK) ELISA Kit

Sign In for Pricing
View Details
MAP3K10 antibody
FNab05214 100 µg

MAP3K10 antibody

Sign In for Pricing
View Details
Human Cadherin-3, C-His Tag
HA211162-01 20 µg

Human Cadherin-3, C-His Tag

Sign In for Pricing
View Details