Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF655 Peptide - N-terminal region

ZNF655 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686M1631, FLJ23461, MGC10859, MGC16203, MGC5521, VIK, VIK-1

UniProt

D6W5T4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076966

Preservative

Lyophilized powder

AA Sequence

QVPALPREGSPGDQAAALLTARYQEFVTFEDVAVHLTREEWGYLDPVQRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+)-Biotinyl 3,6,9-Trioxaundecanediamine
TRC-B395045-50MG 50 mg

(+)-Biotinyl 3,6,9-Trioxaundecanediamine

Sign In for Pricing
View Details
HLA-A Antibody
KC-30888-01 50 μL

HLA-A Antibody

Sign In for Pricing
View Details
HLA-A Antibody
KC-30888-02 100 µL

HLA-A Antibody

Sign In for Pricing
View Details
HLA-A Antibody
KC-30888-03 1 mL

HLA-A Antibody

Sign In for Pricing
View Details
CHODL Rabbit Polyclonal Antibody
TA372234 100 µL

CHODL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNase-I Polyclonal Antibody
D-AB-10417L-01 25 µL

DNase-I Polyclonal Antibody

Sign In for Pricing
View Details