Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF678 Peptide - C-terminal region

ZNF678 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ18355, FLJ22822, MGC15634, MGC42493

UniProt

Q5SXM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF678 Rabbit Polyclonal Antibody (orb575889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848644

Preservative

Lyophilized powder

AA Sequence

QFSSLTRHKRIHTGEKRYKCKECGKGFYQSSIHSKYKRIYTGEEPDKCKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Cys (Acm) -2-CT Polystyrene Resin
H0370753307.25G 25 g

H-Cys (Acm) -2-CT Polystyrene Resin

Sign In for Pricing
View Details
Zc2hc1c Mouse Gene Knockout Kit (CRISPR)
KN519633 1 Kit

Zc2hc1c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF405S conjugate, 0.1mg/mL
BNC040637-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHA-665752
SIH-421-25MG 25 mg

PHA-665752

Sign In for Pricing
View Details
Recombinant Human Neuroligin 1/NLGN1 Protein (His Tag)
PKSH031062 100 µg

Recombinant Human Neuroligin 1/NLGN1 Protein (His Tag)

Sign In for Pricing
View Details
Biotin Peroxidase Colloidal Gold,  5nm
GB-02-5 1 mL

Biotin Peroxidase Colloidal Gold, 5nm

Sign In for Pricing
View Details