Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF678 Peptide - C-terminal region

ZNF678 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ18355, FLJ22822, MGC15634, MGC42493

UniProt

Q5SXM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF678 Rabbit Polyclonal Antibody (orb575889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848644

Preservative

Lyophilized powder

AA Sequence

QFSSLTRHKRIHTGEKRYKCKECGKGFYQSSIHSKYKRIYTGEEPDKCKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT (MCAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B7]
TA507070BM 100 µL

MT (MCAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B7]

Sign In for Pricing
View Details
MYC (Ab-62) Antibody
8B0020-AAT 50 µg

MYC (Ab-62) Antibody

Sign In for Pricing
View Details
Human Meprin A Beta (MEP1b) ELISA Kit
RDR-MEP1b-Hu-01 96 Tests

Human Meprin A Beta (MEP1b) ELISA Kit

Sign In for Pricing
View Details
Human Meprin A Beta (MEP1b) ELISA Kit
RDR-MEP1b-Hu-02 48 Tests

Human Meprin A Beta (MEP1b) ELISA Kit

Sign In for Pricing
View Details
EFHD1 (NM_025202) Human Over-expression Lysate
LY403060 100 µg

EFHD1 (NM_025202) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ANKRD7 activation kit by CRISPRa
GA111182 1 Kit

Human ANKRD7 activation kit by CRISPRa

Sign In for Pricing
View Details