Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF678 Peptide - C-terminal region

ZNF678 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ18355, FLJ22822, MGC15634, MGC42493

UniProt

Q5SXM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF678 Rabbit Polyclonal Antibody (orb575889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848644

Preservative

Lyophilized powder

AA Sequence

QFSSLTRHKRIHTGEKRYKCKECGKGFYQSSIHSKYKRIYTGEEPDKCKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Giardia lamblia (BB1.1E5), 0.2mg/mL
BNUB0210-500 1x 500 µL

Giardia lamblia (BB1.1E5), 0.2mg/mL

Sign In for Pricing
View Details
FLI1 (NM_002017) Human Over-expression Lysate
LC400737 20 µg

FLI1 (NM_002017) Human Over-expression Lysate

Sign In for Pricing
View Details
Zdhhc14 Mouse Gene Knockout Kit (CRISPR)
KN519678 1 Kit

Zdhhc14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details