Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Peptide - N-terminal region

ZNF692 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AREBP, FLJ20531, Zfp692

UniProt

Q9BU19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF692 Rabbit Polyclonal Antibody (orb574536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060335

Preservative

Lyophilized powder

AA Sequence

GGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCAGPEPLPPKGLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (JC/70A), CF594 conjugate, 0.1mg/mL
BNC940639-100 1x 100 µL

CD31 / PECAM-1 (JC/70A), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZBTB10 Polyclonal Antibody
E-AB-19551-01 20 µL

ZBTB10 Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB10 Polyclonal Antibody
E-AB-19551-02 60 µL

ZBTB10 Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB10 Polyclonal Antibody
E-AB-19551-03 120 µL

ZBTB10 Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB10 Polyclonal Antibody
E-AB-19551-04 200 µL

ZBTB10 Polyclonal Antibody

Sign In for Pricing
View Details
Glycine-d2
TRC-G615991-250MG 250 mg

Glycine-d2

Sign In for Pricing
View Details