Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF765 Peptide - N-terminal region

ZNF765 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686J2252

UniProt

Q7L2R6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF765 Rabbit Polyclonal Antibody (orb583973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035275

Preservative

Lyophilized powder

AA Sequence

MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (VCAM1/843), CF405S conjugate, 0.1mg/mL
BNC040843-500 1x 500 µL

CD106 / VCAM1 (VCAM1/843), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (Marker for Human Cells) (GLG1/2829R), 0.2mg/mL
BNUB2829-500 1x 500 µL

Golgi Complex (Marker for Human Cells) (GLG1/2829R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human IL-5 protein (His Tag)
PKSH034100-01 20 µg

Recombinant Human IL-5 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-5 protein (His Tag)
PKSH034100-02 100 µg

Recombinant Human IL-5 protein (His Tag)

Sign In for Pricing
View Details
Anti-ZNF280A
Y058902 100 µg

Anti-ZNF280A

Sign In for Pricing
View Details
Telomerase reverse transcriptase (TERT) pTyr707 Rabbit Polyclonal Antibody
AP13029PU-N 400 µL

Telomerase reverse transcriptase (TERT) pTyr707 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details