Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF765 Peptide - N-terminal region

ZNF765 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686J2252

UniProt

Q7L2R6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF765 Rabbit Polyclonal Antibody (orb583973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035275

Preservative

Lyophilized powder

AA Sequence

MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RDX Polyclonal Antibody
E-AB-10315-01 20 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-10315-02 60 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-10315-03 120 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-10315-04 200 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Collagen XVII alpha 1 Antibody
RC-15296-01 50 μL

Recombinant Collagen XVII alpha 1 Antibody

Sign In for Pricing
View Details
Recombinant Collagen XVII alpha 1 Antibody
RC-15296-02 100 µL

Recombinant Collagen XVII alpha 1 Antibody

Sign In for Pricing
View Details