Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF773 Peptide - C-terminal region

ZNF773 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ00301, MGC4728, ZNF419B

UniProt

Q6PK81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF773 Rabbit Polyclonal Antibody (orb577428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940944

Preservative

Lyophilized powder

AA Sequence

VHTGEKPFKCNECGRFFSENSSLVKHQRVHTGAKPYECRECGKFFRHSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Weigh Boats
B6002B 500 Sheets/Pack

Weigh Boats

Sign In for Pricing
View Details
BCAT1 Mouse Monoclonal Antibody [Clone ID: AT3C8]
AM50619PU-N 100 µL

BCAT1 Mouse Monoclonal Antibody [Clone ID: AT3C8]

Sign In for Pricing
View Details
HES5 (NM_001010926) Human Over-expression Lysate
LC423234 20 µg

HES5 (NM_001010926) Human Over-expression Lysate

Sign In for Pricing
View Details
Aspm Mouse Gene Knockout Kit (CRISPR)
KN501693 1 Kit

Aspm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,3-Bis-(1,6-anhydro-2,3-O-isopropylidene-Beta-D-mannopyranose-4-yloxy)-2-propylamine
TRC-B406025-5MG 5 mg

1,3-Bis-(1,6-anhydro-2,3-O-isopropylidene-Beta-D-mannopyranose-4-yloxy)-2-propylamine

Sign In for Pricing
View Details
PGE2 (Prostaglandin E2) ELISA Kit
E-EL-0034-01 24 Tests

PGE2 (Prostaglandin E2) ELISA Kit

Sign In for Pricing
View Details