Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF773 Peptide - C-terminal region

ZNF773 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ00301, MGC4728, ZNF419B

UniProt

Q6PK81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF773 Rabbit Polyclonal Antibody (orb577428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940944

Preservative

Lyophilized powder

AA Sequence

VHTGEKPFKCNECGRFFSENSSLVKHQRVHTGAKPYECRECGKFFRHSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA5B Rabbit Polyclonal Antibody
TA372155 100 µL

CA5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF594 conjugate, 0.1mg/mL
BNC942218-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD103 Antibody[M290]
E-AB-F1090UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD103 Antibody[M290]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD103 Antibody[M290]
E-AB-F1090UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD103 Antibody[M290]

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF640R conjugate, 0.1mg/mL
BNC401224-500 1x 500 µL

HCG-beta (HCGb/54+ HCGb/459), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
nkx6.1 (NKX6-1) (C-term) Rabbit Polyclonal Antibody
AP52893PU-N 400 µL

nkx6.1 (NKX6-1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details