Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF883 Peptide - N-terminal region

ZNF883 Peptide - N-terminal region

Product Specifications

UniProt

P0CG24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF883 Rabbit Polyclonal Antibody (orb581261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094808

Preservative

Lyophilized powder

AA Sequence

MESEKIYMTANPYLCTECGKGYTCLASLTQHQKTHIGEKPYECKICGKSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf225 Mouse Gene Knockout Kit (CRISPR)
KN500233 1 Kit

Rnf225 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
7-Chloro-4-nitroquinoline
TRC-C374830-25MG 25 mg

7-Chloro-4-nitroquinoline

Sign In for Pricing
View Details
SLFNL1 (N-term) Rabbit Polyclonal Antibody
AP53933PU-N 400 µL

SLFNL1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Becn1 Mouse Gene Knockout Kit (CRISPR)
KN502131 1 Kit

Becn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIP (TRAIP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]
TA800074AM 100 µL

TRIP (TRAIP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]

Sign In for Pricing
View Details
PIK3R5 Human Gene Knockout Kit (CRISPR)
KN422249 1 Kit

PIK3R5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details