Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF883 Peptide - N-terminal region

ZNF883 Peptide - N-terminal region

Product Specifications

UniProt

P0CG24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF883 Rabbit Polyclonal Antibody (orb581261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094808

Preservative

Lyophilized powder

AA Sequence

MESEKIYMTANPYLCTECGKGYTCLASLTQHQKTHIGEKPYECKICGKSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Semaphorin 7a (SEMA7A) (NM_003612) Human Over-expression Lysate
LC401196 20 µg

Semaphorin 7a (SEMA7A) (NM_003612) Human Over-expression Lysate

Sign In for Pricing
View Details
p73 (TP73) Human Gene Knockout Kit (CRISPR)
KN220864LP 1 Kit

p73 (TP73) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL20 Rabbit Polyclonal Antibody
AP20589PU-N 100 µg

IL20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aloin A
TRC-A575415-25MG 25 mg

Aloin A

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS806723 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
Vmn1r139 Mouse Gene Knockout Kit (CRISPR)
KN518939 1 Kit

Vmn1r139 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details