Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZPBP2 Peptide - middle region

ZPBP2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC41930, ZPBPL

UniProt

Q6X784

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZPBP2 Rabbit Polyclonal Antibody (orb582091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942141

Preservative

Lyophilized powder

AA Sequence

VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aqp4 (NM_012825) Rat Tagged Lenti ORF Clone
RR200435L2 10 µg

Aqp4 (NM_012825) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZNF281 Antibody - middle region
OAAB19078-400UL 400 µL

ZNF281 Antibody - middle region

Sign In for Pricing
View Details
ZNF253 Polyclonal Antibody
E97598 100 µL

ZNF253 Polyclonal Antibody

Sign In for Pricing
View Details
HSV1 + HSV2 ICP35 (Herpes Simplex Virus 1 & 2 ICP35) discontinued
367574 200 µg

HSV1 + HSV2 ICP35 (Herpes Simplex Virus 1 & 2 ICP35) discontinued

Sign In for Pricing
View Details
Senp3 ORF Vector (Rat) (pORF)
43373016 1.0 µg DNA

Senp3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
2- (4-Hydroxymethylphenyl) -2,3-dihydro-1H-naphtho[1,8-de][1,3,2]diazaborinine
279780-01 1 g

2- (4-Hydroxymethylphenyl) -2,3-dihydro-1H-naphtho[1,8-de][1,3,2]diazaborinine

Sign In for Pricing
View Details