Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZRANB1 Peptide - C-terminal region

ZRANB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp762P2216, TRABID

UniProt

Q9UGI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060050

Preservative

Lyophilized powder

AA Sequence

GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant c-Jun (phospho S73) /JunD (phospho S100) Antibody
RC-16645-01 50 μL

Recombinant c-Jun (phospho S73) /JunD (phospho S100) Antibody

Sign In for Pricing
View Details
Recombinant c-Jun (phospho S73) /JunD (phospho S100) Antibody
RC-16645-02 100 µL

Recombinant c-Jun (phospho S73) /JunD (phospho S100) Antibody

Sign In for Pricing
View Details
Recombinant c-Jun (phospho S73) /JunD (phospho S100) Antibody
RC-16645-03 1 mL

Recombinant c-Jun (phospho S73) /JunD (phospho S100) Antibody

Sign In for Pricing
View Details
ZNF12 Human Gene Knockout Kit (CRISPR)
KN417917 1 Kit

ZNF12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ST7 (Center) Rabbit Polyclonal Antibody
AP54058PU-N 400 µL

ST7 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD352 Antibody[W19035D]
AN00321C-01 20 Tests

FITC Anti-Human CD352 Antibody[W19035D]

Sign In for Pricing
View Details