Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZRANB2 Peptide - middle region

ZRANB2 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686J1831, DKFZp686N09117, FLJ41119, ZIS, ZIS1, ZIS2, ZNF265

UniProt

O95218

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZRANB2 Rabbit Polyclonal Antibody (orb575619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005446

Preservative

Lyophilized powder

AA Sequence

GYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,4-Benzenetricarboxylic Acid 1,2-Dibutyl Ester
TRC-B190320-50MG 50 mg

1,2,4-Benzenetricarboxylic Acid 1,2-Dibutyl Ester

Sign In for Pricing
View Details
SET (NM_003011) Human Recombinant Protein
TP307606L 1 mg

SET (NM_003011) Human Recombinant Protein

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF488A conjugate, 0.1mg/mL
BNC881564-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phosph-Free Block ELISA Blocking Buffer
6262 100 mL

Phosph-Free Block ELISA Blocking Buffer

Sign In for Pricing
View Details
Il2ra Rat Monoclonal Antibody [Clone ID: 7D4]
AM08035RP-S 100 µg

Il2ra Rat Monoclonal Antibody [Clone ID: 7D4]

Sign In for Pricing
View Details
CD33 Recombinant Rabbit monoclonal Antibody
HA750814 100 µL

CD33 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details