Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZRANB2 Peptide - middle region

ZRANB2 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686J1831, DKFZp686N09117, FLJ41119, ZIS, ZIS1, ZIS2, ZNF265

UniProt

O95218

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZRANB2 Rabbit Polyclonal Antibody (orb575619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005446

Preservative

Lyophilized powder

AA Sequence

GYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DPEP3 activation kit by CRISPRa
GA112008 1 Kit

Human DPEP3 activation kit by CRISPRa

Sign In for Pricing
View Details
5,7-Dichloro-4-hydroxyquinoline
TRC-D437240-50MG 50 mg

5,7-Dichloro-4-hydroxyquinoline

Sign In for Pricing
View Details
2,2,2-Trifluoroethyl Triflate
TRC-T790300-1G 1 g

2,2,2-Trifluoroethyl Triflate

Sign In for Pricing
View Details
Rabbit IgG (H&L) Antibody Peroxidase Conjugated Pre-Adsorbed
TA397935 500 µg

Rabbit IgG (H&L) Antibody Peroxidase Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
Human EREG Antibody Pair Set
E-KAB-0423 50 µL & 100 µg

Human EREG Antibody Pair Set

Sign In for Pricing
View Details
Inosine-13C5 5’-Monophosphate (Triethylammonium Salt)
TRC-S637507-2.5MG 2.5 mg

Inosine-13C5 5’-Monophosphate (Triethylammonium Salt)

Sign In for Pricing
View Details