Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zscan12 Peptide - middle region

Zscan12 Peptide - middle region

Product Specifications

Product Name Alternative

2510038J07Rik, FPM315, Zfp96, mKIAA0426

UniProt

Q9Z1D7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zscan12 Rabbit Polyclonal Antibody (orb577451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057893

Preservative

Lyophilized powder

AA Sequence

WEGTEAEQNPASRLAKDALECEEAHNPGEESSGISHEDSQPLRNENGVNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human I-PTH Protein (TRX Tag)
PDEH100468-01 20 µg

Recombinant Human I-PTH Protein (TRX Tag)

Sign In for Pricing
View Details
Recombinant Human I-PTH Protein (TRX Tag)
PDEH100468-02 100 µg

Recombinant Human I-PTH Protein (TRX Tag)

Sign In for Pricing
View Details
Recombinant Human I-PTH Protein (TRX Tag)
PDEH100468-03 500 µg

Recombinant Human I-PTH Protein (TRX Tag)

Sign In for Pricing
View Details
Recombinant Human I-PTH Protein (TRX Tag)
PDEH100468-04 1 mg

Recombinant Human I-PTH Protein (TRX Tag)

Sign In for Pricing
View Details
ADAM23 Antibody
KC-3979-01 50 μL

ADAM23 Antibody

Sign In for Pricing
View Details
ADAM23 Antibody
KC-3979-02 100 µL

ADAM23 Antibody

Sign In for Pricing
View Details