Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zscan12 Peptide - middle region

Zscan12 Peptide - middle region

Product Specifications

Product Name Alternative

2510038J07Rik, FPM315, Zfp96, mKIAA0426

UniProt

Q9Z1D7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zscan12 Rabbit Polyclonal Antibody (orb577451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057893

Preservative

Lyophilized powder

AA Sequence

WEGTEAEQNPASRLAKDALECEEAHNPGEESSGISHEDSQPLRNENGVNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFAND2B (NM_138802) Human Recombinant Protein
TP303822L 1 mg

ZFAND2B (NM_138802) Human Recombinant Protein

Sign In for Pricing
View Details
PBK/TOPK Antibody
KC-3911-01 50 μL

PBK/TOPK Antibody

Sign In for Pricing
View Details
PBK/TOPK Antibody
KC-3911-02 100 µL

PBK/TOPK Antibody

Sign In for Pricing
View Details
PBK/TOPK Antibody
KC-3911-03 1 mL

PBK/TOPK Antibody

Sign In for Pricing
View Details
SLC30A10 Human Gene Knockout Kit (CRISPR)
KN420219 1 Kit

SLC30A10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Biotin,  40nm
GAB-02-40 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Biotin, 40nm

Sign In for Pricing
View Details