Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem130 Peptide - middle region

Tmem130, transmembrane protein 130, BC067004; MGC157450; MGC157451; C130036G08; Tmem130, transmembrane protein 130, transmembrane protein 130, OTTMUSP00000031094

Product Specifications

Product Name Alternative

BC067004, C130036G08, MGC157450, MGC157451

UniProt

Q6NXM3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_808403

Preservative

Lyophilized powder

AA Sequence

FTVKVRVVAEWEQIKPDTTKGTIQKTGDFSASLDLRESLQGIQILGPTLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Coenzyme Q10 (COQ10) ELISA Kit
MBS9366462-01 48 Well

Horse Coenzyme Q10 (COQ10) ELISA Kit

Sign In for Pricing
View Details
Horse Coenzyme Q10 (COQ10) ELISA Kit
MBS9366462-02 96 Well

Horse Coenzyme Q10 (COQ10) ELISA Kit

Sign In for Pricing
View Details
Horse Coenzyme Q10 (COQ10) ELISA Kit
MBS9366462-03 5x 96 Well

Horse Coenzyme Q10 (COQ10) ELISA Kit

Sign In for Pricing
View Details
Horse Coenzyme Q10 (COQ10) ELISA Kit
MBS9366462-04 10x 96 Well

Horse Coenzyme Q10 (COQ10) ELISA Kit

Sign In for Pricing
View Details
Acid sphingomyelinase Rabbit Polyclonal Antibody (BF555)
orb1576295 100 µL

Acid sphingomyelinase Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Recombinant IBV Hemagglutinin / HA1 Protein (aa 1-362) [His] (B/Wisconsin/01/2012)
VAng-Wyb7111-50g 50 µg

Recombinant IBV Hemagglutinin / HA1 Protein (aa 1-362) [His] (B/Wisconsin/01/2012)

Sign In for Pricing
View Details