Tmem130 Peptide - middle region
Tmem130, transmembrane protein 130, BC067004; MGC157450; MGC157451; C130036G08; Tmem130, transmembrane protein 130, transmembrane protein 130, OTTMUSP00000031094
Product Specifications
Product Name Alternative
BC067004, C130036G08, MGC157450, MGC157451
UniProt
Q6NXM3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_808403
Preservative
Lyophilized powder
AA Sequence
FTVKVRVVAEWEQIKPDTTKGTIQKTGDFSASLDLRESLQGIQILGPTLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
R8234149-FP 2x 1 µg
FFPE and Frozen Matched Pair Total RNA: Human Adult Normal Tissue: Liver
Sign In for Pricing
View Details ARP40761_P050-HRP 100 µL
EXOSC2 Antibody - middle region : HRP (ARP40761_P050-HRP)
Sign In for Pricing
View Details 
RC215225L1V 200 µL
PAICS (NM_006452) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
NHFF-1123-HX105 Each
Cre Expressing Monkey Primary Bladder Microvascular Endothelial Cells
Sign In for Pricing
View Details