Trp53 Peptide - N-terminal region
Trp53, transformation related protein 53, bbl; bfy; bhy; p44; p53; Tp53; Trp53, cellular tumor antigen p53, cellular tumor antigen p53, OTTMUSP00000006194, tumor supressor p53, tumor suppressor p53, p53 cellular tumor antigen
Product Specifications
Product Name Alternative
Bbl, bfy, bhy, p53, p44, Tp53
UniProt
Q549C9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_035770
Preservative
Lyophilized powder
AA Sequence
EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400460-500 1x 500 µL
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682348-100 1x 100 µL
Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401025-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details