Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp53 Peptide - N-terminal region

Trp53, transformation related protein 53, bbl; bfy; bhy; p44; p53; Tp53; Trp53, cellular tumor antigen p53, cellular tumor antigen p53, OTTMUSP00000006194, tumor supressor p53, tumor suppressor p53, p53 cellular tumor antigen

Product Specifications

Product Name Alternative

Bbl, bfy, bhy, p53, p44, Tp53

UniProt

Q549C9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_035770

Preservative

Lyophilized powder

AA Sequence

EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Med10 (NM_001106097) Rat Tagged ORF Clone Lentiviral Particle
RR214760L3V 200 µL

Med10 (NM_001106097) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HERC6 sgRNA CRISPR Lentivector (Human) (Target 1)
K0946602 1.0 µg DNA

HERC6 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
C3orf49 Knockout Hela Polyclonal Cells
ARG41462 1 Million

C3orf49 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
К electrode
A11-120 1 unit

К electrode

Sign In for Pricing
View Details
SPATA20 Rabbit Polyclonal Antibody (HRP)
orb2115002 100 µL

SPATA20 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Bcl-x Protein (Met 1-Arg 212) [GST]
VAng-1105Lsx-100g 100 µg

Recombinant Bcl-x Protein (Met 1-Arg 212) [GST]

Sign In for Pricing
View Details