UBE2T Peptide - N-terminal region
UBE2T, ubiquitin-conjugating enzyme E2T (putative), PIG50; HSPC150; UBE2T, ubiquitin-conjugating enzyme E2 T, ubiquitin-conjugating enzyme E2 T, ubiquitin-protein ligase T, ubiquitin carrier protein T, ubiquitin conjugating enzyme, cell proliferation-inducing gene 50 protein, HSPC150 protein similar to ubiquitin-conjugating enzyme
Product Specifications
Product Name Alternative
HSPC150, PIG50
UniProt
Q9NPD8
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_054895
Preservative
Lyophilized powder
AA Sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7252606-01 48 Well
Bovine Cell division cycle-associated protein 7 (CDCA7) ELISA Kit
Sign In for Pricing
View Details MBS7252606-02 96 Well
Bovine Cell division cycle-associated protein 7 (CDCA7) ELISA Kit
Sign In for Pricing
View Details MBS7252606-03 5x 96 Well
Bovine Cell division cycle-associated protein 7 (CDCA7) ELISA Kit
Sign In for Pricing
View Details MBS7252606-04 10x 96 Well
Bovine Cell division cycle-associated protein 7 (CDCA7) ELISA Kit
Sign In for Pricing
View Details 