Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT1A5 Peptide - N-terminal region

UGT1A5, UDP glucuronosyltransferase 1 family, polypeptide A5, UDPGT; UGT1E; UDPGT 1-5; UGT1A5, UDP-glucuronosyltransferase 1-5, UDP-glucuronosyltransferase 1-5, UGT-1E, UGT1*5, OTTHUMP00000065199, UDP-glucuronosyltransferase 1-E, UDP-glucuronosyltransferase 1A5, UDP glycosyltransferase 1 family, polypeptide A5, UDP-glucuronosyltransferase 1 family polypeptide A5s

Product Specifications

Product Name Alternative

UDPGT, UGT1E, UDPGT 1-5

UniProt

P35504

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_061951

Preservative

Lyophilized powder

AA Sequence

EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Protein-Arginine Deiminase Type-4 (PADI4) ELISA Kit
MBS9924417 Inquire

Goose Protein-Arginine Deiminase Type-4 (PADI4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ETS1 associated protein II Antibody
NB600-247 0.1 mL

Rabbit Polyclonal ETS1 associated protein II Antibody

Sign In for Pricing
View Details
Breast cancer suppressor candidate 1 (VWA5A) Human Over-expression Lysate
orb1340967 100 µg

Breast cancer suppressor candidate 1 (VWA5A) Human Over-expression Lysate

Sign In for Pricing
View Details
Fibronectin Fragment [Phe1376] (1371-1382)
F4215-98S 1 mg

Fibronectin Fragment [Phe1376] (1371-1382)

Sign In for Pricing
View Details
Amphiphysin Rabbit pAb
E47R2409 100 µL

Amphiphysin Rabbit pAb

Sign In for Pricing
View Details
IRAK3 Protein Lysate
OCOA01915-20UG 20 µg

IRAK3 Protein Lysate

Sign In for Pricing
View Details