Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UMODL1 Peptide - middle region

UMODL1, uromodulin-like 1, UMODL1, uromodulin-like 1, uromodulin-like 1, olfactorin, OTTHUMP00000109312, OTTHUMP00000109313

Product Specifications

UniProt

Q5DID0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001004416

Preservative

Lyophilized powder

AA Sequence

EMQLFIGDSPIPQNYSVSASDDVRIEVGLYRQKSNLKVVLTECWATPSSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TRPC3 Rabbit pAb
GB111207-50 50 μL

Anti-TRPC3 Rabbit pAb

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8) ELISA Kit
MBS7224079-01 48 Well

Mouse Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8) ELISA Kit
MBS7224079-02 96 Well

Mouse Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8) ELISA Kit
MBS7224079-03 5x 96 Well

Mouse Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8) ELISA Kit
MBS7224079-04 10x 96 Well

Mouse Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8) ELISA Kit

Sign In for Pricing
View Details
1-iodo-4- (tert-pentyl) benzene
OR1099927-01 250 mg

1-iodo-4- (tert-pentyl) benzene

Sign In for Pricing
View Details