Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UMODL1 Peptide - middle region

UMODL1, uromodulin-like 1, UMODL1, uromodulin-like 1, uromodulin-like 1, olfactorin, OTTHUMP00000109312, OTTHUMP00000109313

Product Specifications

UniProt

Q5DID0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001004416

Preservative

Lyophilized powder

AA Sequence

EMQLFIGDSPIPQNYSVSASDDVRIEVGLYRQKSNLKVVLTECWATPSSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myeloperoxidase (MPO) Anti-antigen ELISA Kit
EKN43575 96 Tests

Human Myeloperoxidase (MPO) Anti-antigen ELISA Kit

Sign In for Pricing
View Details
Phosphate acceptor peptide
HY-P3770 1 Each

Phosphate acceptor peptide

Sign In for Pricing
View Details
Anti-PON1 Antibody Picoband® (monoclonal, 6B1) Fluoro594 Conjugated
M00516-1-Fluoro594 100 µg/Vial

Anti-PON1 Antibody Picoband® (monoclonal, 6B1) Fluoro594 Conjugated

Sign In for Pricing
View Details
DDR2 AAV Vector (Rat) (CMV)
17786106 1 µg

DDR2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
SPATA5 (NM_145207) Human Recombinant Protein
PH36778M5 20 µg

SPATA5 (NM_145207) Human Recombinant Protein

Sign In for Pricing
View Details
Trigonelline Chloride
TRC-T794053-1G 1 g

Trigonelline Chloride

Sign In for Pricing
View Details