Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS41 Peptide - middle region

VPS41, vacuolar protein sorting 41 homolog (S. cerevisiae), HVPS41; HVSP41; hVps41p; VPS41, vacuolar protein sorting-associated protein 41 homolog, vacuolar protein sorting-associated protein 41 homolog, S53, vacuolar assembly protein 41

Product Specifications

Product Name Alternative

HVPS41, HVSP41, hVps41p

UniProt

P49754

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_542198

Preservative

Lyophilized powder

AA Sequence

VIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PREB Antibody
RC-4199-01 50 μL

Recombinant PREB Antibody

Sign In for Pricing
View Details
Recombinant PREB Antibody
RC-4199-02 100 µL

Recombinant PREB Antibody

Sign In for Pricing
View Details
Recombinant PREB Antibody
RC-4199-03 1 mL

Recombinant PREB Antibody

Sign In for Pricing
View Details
Bend5 Mouse Gene Knockout Kit (CRISPR)
KN502135 1 Kit

Bend5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® R Br
R28901.25G 25 g

TentaGel® R Br

Sign In for Pricing
View Details
2,6-Diaminopurine Arabinoside
TRC-D416738-500MG 500 mg

2,6-Diaminopurine Arabinoside

Sign In for Pricing
View Details