Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS41 Peptide - middle region

VPS41, vacuolar protein sorting 41 homolog (S. cerevisiae), HVPS41; HVSP41; hVps41p; VPS41, vacuolar protein sorting-associated protein 41 homolog, vacuolar protein sorting-associated protein 41 homolog, S53, vacuolar assembly protein 41

Product Specifications

Product Name Alternative

HVPS41, HVSP41, hVps41p

UniProt

P49754

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_542198

Preservative

Lyophilized powder

AA Sequence

VIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD30 Ligand (TNFSF8) Protein
abx065921-01 10 µg

Mouse CD30 Ligand (TNFSF8) Protein

Sign In for Pricing
View Details
Mouse CD30 Ligand (TNFSF8) Protein
abx065921-02 50 µg

Mouse CD30 Ligand (TNFSF8) Protein

Sign In for Pricing
View Details
Mouse CD30 Ligand (TNFSF8) Protein
abx065921-03 100 µg

Mouse CD30 Ligand (TNFSF8) Protein

Sign In for Pricing
View Details
Mouse CD30 Ligand (TNFSF8) Protein
abx065921-04 200 µg

Mouse CD30 Ligand (TNFSF8) Protein

Sign In for Pricing
View Details
Mouse CD30 Ligand (TNFSF8) Protein
abx065921-05 500 µg

Mouse CD30 Ligand (TNFSF8) Protein

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Karyopherin Beta (KPNb1)
MBS2095817-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Karyopherin Beta (KPNb1)

Sign In for Pricing
View Details