Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WBP4 Peptide - N-terminal region

WBP4, WW domain binding protein 4 (formin binding protein 21), FBP21; MGC117310; WBP4, WW domain-binding protein 4, WW domain-binding protein 4, WBP-4, formin binding protein 21, formin-binding protein 21, domain-containing binding protein 4, WW domain-containing binding protein 4, WW domain-containing-binding protein 4

Product Specifications

Product Name Alternative

FBP21, MGC117310

UniProt

O75554

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_009118

Preservative

Lyophilized powder

AA Sequence

NHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG16L2 Rabbit pAb
A14948-01 20 µL

ATG16L2 Rabbit pAb

Sign In for Pricing
View Details
ATG16L2 Rabbit pAb
A14948-02 100 μL

ATG16L2 Rabbit pAb

Sign In for Pricing
View Details
ATG16L2 Rabbit pAb
A14948-03 500 μL

ATG16L2 Rabbit pAb

Sign In for Pricing
View Details
ATG16L2 Rabbit pAb
A14948-04 1000 μL

ATG16L2 Rabbit pAb

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS517774 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
MRS2P2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1339604 1.0 µg DNA

MRS2P2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details