Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP52 Peptide - middle region

WDR16, WD repeat domain 16, WDRPUH; FLJ37528; WDR16, WD repeat-containing protein 16, WD repeat-containing protein 16, WD40-repeat protein upregulated in HCC, WD40-repeat protein up-regulated in HCC

Product Specifications

Product Name Alternative

WDR16, WDRPUH

UniProt

Q8N1V2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001074025

Preservative

Lyophilized powder

AA Sequence

ILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Twist-related protein 1 (TWIST1) Elisa Kit
EK713994 96 Well

Human Twist-related protein 1 (TWIST1) Elisa Kit

Sign In for Pricing
View Details
Lentiviral human SGCG shRNA (UAS) - Lentiviral human SGCG shRNA (UAS) (100)
GTR15318957 1 Vial

Lentiviral human SGCG shRNA (UAS) - Lentiviral human SGCG shRNA (UAS) (100)

Sign In for Pricing
View Details
Mycbp Rabbit Polyclonal Antibody
orb576035 100 µL

Mycbp Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPXP3 CRISPRa sgRNA lentivector (set of three targets)(Human)
58343121 3x 1.0µg DNA

GPXP3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Human Sulfotransferase 1A4 (ST1A4)
orb3011396-01 20 µg

Recombinant Human Sulfotransferase 1A4 (ST1A4)

Sign In for Pricing
View Details
Recombinant Human Sulfotransferase 1A4 (ST1A4)
orb3011396-02 100 µg

Recombinant Human Sulfotransferase 1A4 (ST1A4)

Sign In for Pricing
View Details