Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF226 Peptide - middle region

ZNF226, zinc finger protein 226, ZNF226, zinc finger protein 226, zinc finger protein 226, Kruppel-associated box protein

Product Specifications

UniProt

Q9NYT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001027544

Preservative

Lyophilized powder

AA Sequence

ACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANP32C (NM_012403) Human Tagged ORF Clone Lentiviral Particle
RC215880L4V 200 µL

ANP32C (NM_012403) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SGSM2 Rabbit Polyclonal Antibody (BF555)
orb2466183 100 µL

SGSM2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Mast1 AAV siRNA Pooled Vector
28136164 1.0 µg

Mast1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SUGT1 Protein Vector (Human) (pPB-C-His)
PV134122 500 ng

SUGT1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rat myelin protein 2 (p2) ELISA Kit
EIA07799r 1 Kit

Rat myelin protein 2 (p2) ELISA Kit

Sign In for Pricing
View Details
ZNF42 (MZF1, MZF, ZSCAN6, Myeloid zinc finger 1, MZF-1, Zinc finger and SCAN domain-containing protein 6, Zinc finger protein 42)
325062-01 50 µg

ZNF42 (MZF1, MZF, ZSCAN6, Myeloid zinc finger 1, MZF-1, Zinc finger and SCAN domain-containing protein 6, Zinc finger protein 42)

Sign In for Pricing
View Details