Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF226 Peptide - middle region

ZNF226, zinc finger protein 226, ZNF226, zinc finger protein 226, zinc finger protein 226, Kruppel-associated box protein

Product Specifications

UniProt

Q9NYT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001027544

Preservative

Lyophilized powder

AA Sequence

ACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM1 Human shRNA Plasmid Kit (Locus ID 116285)
TR306864 1 Kit

ACSM1 Human shRNA Plasmid Kit (Locus ID 116285)

Sign In for Pricing
View Details
Anti-Vitronectin/VTN Antibody Picoband® Fluoro488 Conjugated
PB9458-Fluoro488 100 µg/Vial

Anti-Vitronectin/VTN Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Recombinant Enterobacteria phage RB18 Translation repressor protein (regA)
MBS1222609-01 0.02 mg (E-Coli)

Recombinant Enterobacteria phage RB18 Translation repressor protein (regA)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage RB18 Translation repressor protein (regA)
MBS1222609-02 0.1 mg (E-Coli)

Recombinant Enterobacteria phage RB18 Translation repressor protein (regA)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage RB18 Translation repressor protein (regA)
MBS1222609-03 0.02 mg (Yeast)

Recombinant Enterobacteria phage RB18 Translation repressor protein (regA)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage RB18 Translation repressor protein (regA)
MBS1222609-04 0.1 mg (Yeast)

Recombinant Enterobacteria phage RB18 Translation repressor protein (regA)

Sign In for Pricing
View Details