Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zscan12 Peptide - C-terminal region

Zscan12, zinc finger and SCAN domain containing 12, Zfp96; FPM315; mKIAA0426; 2510038J07Rik; Zscan12, zinc finger and SCAN domain-containing protein 12, zinc finger and SCAN domain-containing protein 12, zfp-96, OTTMUSP00000000442, OTTMUSP00000000443, zinc finger protein 96

Product Specifications

Product Name Alternative

2510038J07Rik, FPM315, Zfp96, mKIAA0426

UniProt

Q9Z1D7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_057893

Preservative

Lyophilized powder

AA Sequence

NSSLATHQETHHKEKPFTQSGPIQQQRNHTKEKPYKCSVCGKAFIQKISL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transforming Growth Factor β Stimulated Protein Clone 22 ELISA kit
GTR10475954 96 Well

Human Transforming Growth Factor β Stimulated Protein Clone 22 ELISA kit

Sign In for Pricing
View Details
3-morpholin-4-ylbutan-1-ol
sc-289213 100 mg

3-morpholin-4-ylbutan-1-ol

Sign In for Pricing
View Details
Rabbit Polyclonal Ninein Antibody [Alexa Fluor 700]
NBP2-97595AF700 0.1 mL

Rabbit Polyclonal Ninein Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
500 mL Single-Use Storage Bottle (NG)
BIOBGBTB500ML011 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

500 mL Single-Use Storage Bottle (NG)

Sign In for Pricing
View Details
PRSS55 Human Over-expression Lysate
orb1359254 20 µg

PRSS55 Human Over-expression Lysate

Sign In for Pricing
View Details
Histone Acetyl transferase KAT5 (KAT5) Human ELISA Kit
E0459 96 Tests

Histone Acetyl transferase KAT5 (KAT5) Human ELISA Kit

Sign In for Pricing
View Details